+ iHjr a0t$Rt^RIHt^RIt^RIt^RIt^RIt^RIt^RI H t ^RI H t ^RI HtHt^RIHt]P$!R4tRt0RmtRtRt]!0R kR kR kR kR kRkRkRkRkRkRkRkRkRkRkRkRkRkRkRkRkRkRkR kR!kR"kR#kR$kR%kR&kR'kR(kR)kR*kR+kR,kR-kR.kR/kR0kR1kR2k4t]!0Rm4tR3tRtRtRt^tRt R4t!R5RR6R/t"R7]#R8&R9t$R:t%R;t&Rt'/](PSRR<4C](PSRR=4C](PSRR>4Ct*] !R?R@7!RARB44t+]+!RCRD7t,]+!R]]$R]'RE7t-RFRGlt.RHRIlt/RJRKlt0RLRMlt1RNROlt2RPRQlt3RRRSlt4RTRUlt5RVRWlt6RXRYlt7RZR[lt8R\R]lt9] !R?R@7!R^R_44t:R`RRaRRbRRcR/RdRellt;R`RRaRRbR/RfRglltR`RRaRRbRRcRRlRRmR/RnRollt?R`RRaRRbR/RpRqllt@RrRsltARtRultBRvRwltC] !R?R@7!RxRy44tDRzR{ltER|R}ltFRR~RlltGRtHRRRlltIR#)aCoding-context awareness: the single place that decides "are we coding?". In a code workspace on an interactive surface Hermes adopts a **coding posture**: a frozen :class:`RuntimeMode` built from a :class:`ContextProfile` (pure data). The system prompt reads ``system_prompt_parts()``; the toolset collapses ONLY under opt-in ``focus`` (never strips a user-enabled toolset). ``agent.coding_context``: ``auto`` (default, prompt-only) / ``focus`` / ``on`` / ``off``. Resolved once, immutable; the workspace snapshot is probed once per session and replayed through ``system_prompt_parts(workspace_block=...)`` on every later build (cache safety). ) annotationsN) dataclass)Path)AnyOptional)bounded_git_probezhermes.coding_contextcodingz.pyz.pyiz.ipynbz.jsz.jsxz.tsz.tsxz.mjsz.cjsz.goz.rsz.javaz.ktz.ktsz.scalaz.rbz.phpz.cz.hz.ccz.cppz.hppz.csz.swiftz.mz.mmz.dartz.exz.exsz.luaz.shz.bashz.zshz.sqlz.vuez.sveltez.rz.jlz.hsz.cljz.erlz.plig@patchreplacez&dict[str, tuple[tuple[str, ...], str]]_EDIT_FORMAT_GUIDANCEuU You are a coding agent pairing with the user inside their codebase. Operate like a careful senior engineer. Gather context first: - Read the relevant files with `read_file` and locate code with `search_files` before changing anything. Trace a symbol to its definition and usages rather than guessing its shape. - Batch independent lookups: when several reads/searches don't depend on each other, issue them together in one turn instead of one at a time. - Never invent files, symbols, APIs, or imports. If you haven't seen it in the repo, go look. Don't assume a library is available — check the project manifest (pyproject.toml / package.json / Cargo.toml / go.mod) and how neighbouring files import it. Make changes through the tools, not the chat: - Edit with `patch`/`write_file`. Do NOT print code blocks to the user as a substitute for editing — apply the change, then summarise it. Only show code when the user explicitly asks to see it. - Match the project's existing style and conventions; AGENTS.md / CLAUDE.md / .cursorrules already in context win over your defaults. Touch only what the task needs — no drive-by refactors, renames, or reformatting — and add any imports/dependencies your code requires. - If an edit fails to apply, re-read the file to get the current exact contents before retrying — don't repeat a stale patch. If the same region fails twice, rewrite the enclosing function or file with `write_file` instead of attempting a third patch. Verify, and know when to stop: - Use `terminal` for git, builds, tests, and inspection. Run the relevant tests/linter/build and confirm they pass before claiming the work is done. - Terminal state persists across calls: current directory and exported environment variables carry forward. Activate a virtualenv or export setup vars once, then reuse that state instead of re-sourcing it before every test command. - Fix root causes, not symptoms: when you find a bug, check sibling call paths for the same flaw and fix the class, not just the reported site. - When fixing linter/type errors on a file, stop after about three attempts on the same file and ask the user rather than looping. - Track multi-step work with `todo_list`. Reference code as `path:line` instead of pasting whole files. Respect the user's repo: don't commit, push, or rewrite history unless asked, and never read, print, or commit secrets — leave `.env` and credential files alone unless the user explicitly asks. The Workspace block below is a snapshot from session start — re-run `git status`/`git branch` before relying on it. Be concise: lead with the change or answer, not a preamble.zg- Track multi-step work with `todo_list`. Reference code as `path:line` instead of pasting whole files.z?- Reference code as `path:line` instead of pasting whole files.focusonoffT)frozenc^]tRt^t$RtR]R&RtR]R&RtR]R&RtR]R &R t R ]R &R t R#) ContextProfileuA named operating posture (pure data). ``toolset``: collapse target under ``focus`` (``None`` keeps the platform default). ``compact_skill_categories``: DEMOTED to names-only under ``focus`` — deny-list, never hidden, so recall keeps working.strnameN Optional[str]toolsetguidance model_hintztuple[str, ...]compact_skill_categories) __name__ __module__ __qualname____firstlineno____doc____annotations__rrrr__static_attributes__r9/home/ubuntu/.hermes/hermes-agent/agent/coding_context.pyrrs8X I!G]!Hc $J $02o2r"rgeneral)r)rrrrrc V^8dQhRRRR/#)modelrreturnr)formats"r# __annotate__r*s=r"caT;'gRP4o\P4FVwpwr#S'gK\;QJdV3RlV4F 'gK RM RM!V3RlV44'gKTVu# R#)zMEdit-format family key for a model id, or ``None`` (neutral wording applies).rc3,<"TF qS9xK R#5iNr).0nlowereds& r# _model_family..s9A<sTFN)lowerr itemsany)r'familyneedles_liner0s& @r# _model_familyr9sb{{!!#G$9$?$?$A   7ss99sss9999M%B r"c ,V^8dQhRRRRRRRRR R/#) r&configOptional[dict[str, Any]]keyrdefaultrreadonlyboolr(r)r)s"r#r*r*s9EE 8EsESE_cEhkEr"cVf ^RIHpHpV'dV!4MV!4pT;'g/P R/4;'g/P W4# \d/pLDi;i)z>``config["agent"][key]``, loading config when none was passed.) load_configload_config_readonlyagent)hermes_cli.configrBrC Exceptionget)r;r=r>r?rBrCs&&&$ r#_agent_config_valuerHsb ~  K/7)+[]F\\r  w + 1 1r 6 6s DD F sAA A)(A)c V^8dQhRRRR/#)r&r;r<r(rr)r)s"r#r*r*s??1?c?r"c\VRRRR7p\P\V4P 4P 4R4#)z=Normalized ``agent.coding_context`` mode (auto/focus/on/off).coding_contextautoTr?)rH _MODE_ALIASESrGrstripr3)r;raws& r# _coding_moderQs: f&6 NC   SX^^-335v >>r"c V^8dQhRRRR/#)r&cwdOptional[str | Path]r(rr)r)s"r#r*r*s!!*!t!r"cV'd\V4P4#^RIHpV!4# \d"\\ P !44u#i;i))resolve_agent_cwd)r expanduseragent.runtime_cwdrWrFosgetcwd)rSrWs& r# _resolve_cwdr\sI Cy##%%!7 "" !BIIK  !s 0)AAc V^8dQhRRRR/#r&rSrr(Optional[Path]r)r)s"r#r*r*sYY4YNYr"cbVP4p\RV.VPO4R4#)c3b"TF%qR, P4'gK!VxK' R#5i).gitNexists)r.ps& r#r1_git_root..s!Q7qJ;N;N;P7s/ /N)resolvenextparents)rScurrents& r# _git_rootrks-kkmG QW7w7QSW XXr"cV^8dQhRR/#)r&r(r_r)r)s"r#r*r*s~r"cz\P!4P4# \\3dR#i;ir-)rhomergOSError RuntimeErrorrr"r#_homerqs3yy{""$$ \ "s "%::c V^8dQhRRRR/#r^r)r)s"r#r*r*s  d ~ r"caVP4p\\P!44P4p\ 4V3pV.VP O5R,FXoSV9gK \;QJd#V3Rl\4F 'gK RM RM!V3Rl\44'gKVSu# R# \dRpLi;i)uNearest ancestor (≤6 levels) that looks like a project root, or ``None``. ``$HOME`` and the shared temp root are skipped: a Makefile/AGENTS.md in the home dir is global config, and a stray manifest in /tmp must not flip every session under it.N:NNc3R<"TFpSV, P4xK R#5ir-rc)r.markerparents& r#r1_marker_root..s#%`O_Vv&>&>&@&@O_s$'TF) rgrtempfile gettempdirrFrqrir5_PROJECT_MARKERS)rSrj temp_rootskiprws& @r# _marker_rootr~skkmG,,./779  GY D-W__-b11  ##%`O_%`###%`O_%`"`"`M2   s,C CCc V^8dQhRRRR/#)r&rootrr(r@r)r)s"r#r*r*s$4r"cP^pVR3.pV'Ed[VP4wr4\P!V4pT;_uu_4TEFpT^, pT\8d RRR4R#TP 4'dU\P PTP4^,P4\9d RRR4R#KT'dTP4'dfTP\9dNTPPR4'g*TP\TP 4R34EK EKEKEKEK RRR4EKcR# \dEKti;i \dEKHi;i +'giEK;i)zEBounded check for source files in the root and its immediate subdirs.TNF.)poprZscandirro_CODE_SCAN_MAX_ENTRIESis_filepathsplitextrr3_CODE_EXTENSIONSis_dir_CODE_SCAN_SKIP_DIRS startswithappendr)rseenstack directoryis_rootentriesentrys& r#_has_code_filesrsQ DD\NE %"YY[  jj+GW  00 W }}77++EJJ7:@@BFVV#'WW U\\^^ J^8^glgqgqg|g|~AhBhB d5::&6%>?hB8^^!W    WWslE-F+FAFFFFF35F)&FF- E=<E= F FF F F% c(V^8dQhRRRRRRRR/#)r&moderplatformrSrr(rr)r)s"r#r*r*s(#4Nr"c<VR8Xd\#VR8Xd\#V'd.VP4P4\9d\#\ V4e\#\ V4pVe'V\48wd\V4'd\#\#)a``auto``/``focus``: coding when the surface is interactive AND the cwd is a code workspace (project root, or a git repo that actually holds code; a repo rooted at ``$HOME`` is NOT a signal). ``on``/``off`` force. Not memoized: one gateway serves many cwds.rr ) GENERAL_PROFILECODING_PROFILErOr3INTERACTIVE_CODING_PLATFORMSr~rkrqr)rrrSgit_roots&&& r#_detect_profilers~ u} t|HNN$**,4PPC$~HEG 38Q8Q r"c V^8dQhRRRR/#r&r;r<r( list[str]r)r)s"r#r*r*s  !9 i r"c^RIHp^RIHp\ T!VfV!444#T44# \ d\ PRRR7.u#i;i)uNames of MCP servers the user has enabled — kept in the coding posture. The profile default's resolver, so plugin-provided servers stay too; *config* None reads the user's config.)read_raw_config)enabled_mcp_server_namesz9Could not list enabled MCP servers for the coding postureT)exc_info)rErhermes_cli.tools_configrsortedrFloggerdebug)r;rrs& r#_enabled_mcp_serversrsW5D.FN/@_``X^_``  P[_ ` s%2 2$AAc V^8dQhRRRR/#rr)r)s"r#r*r*$s;;6;9;r"c&\.\V4O#)zCThe coding posture's toolset list; callers own the ``focus`` check.)CODING_TOOLSETrr;s&r#_posture_toolsetsr$s  :1&9 ::r"c V^8dQhRRRR/#r&r;r<r(Optional[list[str]]r)r)s"r#r*r*)s RR3R8KRr"c<\V4R8Xd \V4#R#)zThe coding posture's toolsets when ``agent.coding_context`` is ``focus``, else None, for a session whose workspace decision is already made (no cwd probe).r N)rQrrs&r#focus_toolsetsr)s!)5V(<(G V $QTQr"c]tRtRt$RtR]R&R]R&R]R&R tR]R &R tR ]R &RtR]R&] RRl4t ] RRl4t RRRllt RRRllt RRltRRltRtR #) RuntimeModei1aPThe resolved operating posture for a session; immutable, built once via :func:`resolve_runtime_mode` and never re-resolved mid-session (prompt cache). ``config_mode``: normalized ``agent.coding_context`` (toolset collapse gated on ``focus``); ``model``: steers edit-format guidance only; ``instructions``: ``agent.coding_instructions``.rprofilersurfacerrSrL config_modeNrr'r instructionscV^8dQhRR/#)r&r(rr)r)s"r#r*RuntimeMode.__annotate__As!!c!r"c .VPP#r-)rrselfs&r#kindRuntimeMode.kind@s||   r"cV^8dQhRR/#)r&r(r@r)r)s"r#r*rEs8848r"c PVPP\P8H#r-)rrrrs&r# is_codingRuntimeMode.is_codingDs||  N$7$777r"c V^8dQhRRRR/#rr)r)s"r#r*rHs))(@)L_)r"c nVPR8wgVPPfR#\V4#)zToolset list (only under ``focus``), or ``None`` to keep the platform default. Callers apply it only when the user hasn't pinned a selection (``--toolsets``, ``HERMES_TUI_TOOLSETS``). *config* None lists MCP servers from the user's config.r N)rrrr)rr;s&&r#toolset_selectionRuntimeMode.toolset_selectionHs/   w &$,,*>*>*F ((r"c V^8dQhRRRR/#)r&workspace_blockrr(&tuple[list[str], list[str], list[str]]r)r)s"r#r*rPs#BB-BdJBr"c VP'g...3#.pVPP'dVPPpVe"RV9dVP\\ 4p\ VP4pVeV R\V,^, 2pVPV4Vf\VP4MTpVP'dRVP 2.M.pY6'dV.V3#.V3#)uiReturn (prefix, workspace, trailing) posture blocks in the historical flat order — brief, snapshot, operator instructions — so prompt assembly can put a cache boundary before the snapshot without changing persisted bytes. The brief carries the model-family edit-format nudge (one cached string); ``valid_tool_names`` drops the ``todo_list`` sentence when that tool isn't loaded; operator instructions ride their own block so the brief stays byte-stable. ``workspace_block`` replays a snapshot the caller already pinned at session start (``""`` = no workspace) instead of re-running the git probe; ``None`` probes. todo_list z%Operator instructions (from config): ) rrrr _TODO_SENTENCE_NO_TODO_SENTENCEr9r'r rbuild_coding_workspace_blockrSr)rvalid_tool_namesrprefixbriefr6 workspacetrailings&&& r#system_prompt_partsRuntimeMode.system_prompt_partsPs~~~r2:  << LL))E+ CS0S n6GH"4::.F! '$9&$A!$D#EF MM% >M>U0:[j UYUfUfUf&>&@#8//)/h//r"cV^8dQhRR/#)r&r(frozenset[str]r)r)s"r#r*rms@@.@r"c VP'dVPR8wd \4#\VPP4#)zSkill categories to demote to names-only in the skill index. Gated on ``focus`` like the toolset collapse (index changes under ``auto`` proved too surprising). Demoted, never hidden: pruning caused silent capability loss.r )rr frozensetrrrs&r#r$RuntimeMode.compact_skill_categoriesms7~~~!1!1W!<; >>??r"rr-)NN)rrrrrr rr'rpropertyrrrrrrr!rr"r#rr1sy&  L IKE=L# !!88)B00 @@r"rrrSr;r'c ,V^8dQhRRRRRRRRRR /#) r&rrrSrTr;r<r'r(rr)r)s"r#r*r*vs6,@Qi r"c h\V4p\V4p\VRRRR7p\V\\ 34'dTM T;'gR.pRP RV44p\\YP;'gRP4P4V4T;'gRVVVVR7#)uXResolve the operating posture once (a handful of ``stat`` calls) — the single entry point every domain should call; the result is safe to hold for the session. ``model`` only steers edit-format guidance; ``agent.coding_instructions`` (str or list) becomes the trailing block so a user can pin workflow rules without editing the shipped brief.coding_instructionsrFrMrc3"TF?p\V4P4'gK$\V4P4xKA R#5ir-)rrO)r.items& r#r1'resolve_runtime_mode..s.V54CIOODU.SY__..5s !A !A )rrrSrr'r) r\rQrH isinstancelisttuplejoinrrrOr3) rrSr;r' resolved_cwdrrPr4rs $$$$ r#resolve_runtime_modervs $L  D f&;R% PCcD%=11C r{E99V5VVL ~~2&<&<&>&D&D&F UB !  r"c(V^8dQhRRRRRRRR/# r&rrrSrTr;r<r(r@r)r)s"r#r*r*s5UU=U>RUc{UHLUr"c0\WVR7P#)z>Whether Hermes should operate in its coding posture right now.rrSr;)rrrs$$$r#is_coding_contextrs 6 J T TTr"c(V^8dQhRRRRRRRR/#rr)r)s"r#r*r*s5llMl?Sld|lIMlr"cH\V4R8H;'d\WVR7#)zWhether *cwd* selects the coding posture's toolsets (``focus`` and a code workspace), without building them; ``focus_toolsets`` builds them once the decision is made.r r)rQrrs$$$r#in_focus_workspacers%  7 * k k/@(dj/kkr"c(V^8dQhRRRRRRRR/#) r&rrrSrTr;r<r(rr)r)s"r#r*r*s5ee-e=QebzeGZer"c^\V4R8wdR#\WVR7PV4#)zPToolset selection for the coding posture (``None`` unless ``focus`` and active).r Nr)rQrrrs$$$r#coding_selectionrs+Fw& 6 J \ \]c ddr"rrc 0V^8dQhRRRRRRRRRRR R /#) r&rrrSrTr;r<r'rr(rr)r)s"r#r*r*sFhhh,@hQih hIVh,hr"c@\WW#R7pVPWER7#)zReturn coding prefix, workspace snapshot, and trailing guidance. ``workspace_block`` replays the caller's pinned session-start snapshot instead of probing git again.)rrSr;r')rr)rr)rrSr;r'rrrs$$$$$$ r#coding_system_prompt_partsrs% 6 WD  # #5E # ggr"c(V^8dQhRRRRRRRR/#) r&rrrSrTr;r<r(rr)r)s"r#r*r*s9fffL`frJfVdfr"c8\WVR7P4#)zTSkill categories the active posture demotes to names-only (empty outside ``focus``).r)rrrs$$$r#coding_compact_skill_categoriesrs 6 J c c eer"c$V^8dQhRRRRRR/#)r&rSrargsrr(r)r)s"r#r*r*s&SSdS3S3Sr"c@\RR\V4.VO\R7#)u``git -C `` → stripped stdout, or ``""`` on any failure. bounded_git_probe bounds post-kill cleanup on Windows — plain ``subprocess.run(timeout=...)`` deadlocked when a killed git left a suspended descendant holding the pipe handles. See #66037. git-C)timeout)rr _GIT_TIMEOUT)rSrs&*r#_gitrs! eT3s8;d;\ RRr"c V^8dQhRRRR/#)r& porcelainrr(z%tuple[dict[str, str], dict[str, int]]r)r)s"r#r*r*sS%Jr"c/pR^R^R^R^/pVP4EF_pVPR4'd6VP^R7pVR,W^,PR4&KPVPR4'dJVP4pV^,P R4V^,P R 4uVR &VR &KVPR4'd[VP^R7^,pVR;;,V^,R 8g, uu&VR;;,V^,R 8g, uu&EK!VPR4'gEK;Y#^,R 8XdRMR;;,^, uu&EKb W3#)zAParse ``git status --porcelain=2 --branch`` into branch + counts.stagedmodified untracked conflicts)maxsplitzbranch.z # branch.ab+-aheadbehindru)z # branch.headz# branch.upstream)z1 z2 )zu z? ) splitlinesrsplit removeprefixlstrip)r branchcountslinepartsxys& r# _parse_statusrs<F:q+q+q IF$$& ??A B BJJJ*E7r"c V^8dQhRRRR/#)r&rrr(rr)r)s"r#r*r*sdsr"cVP4'd$VP4P\8dR#VP RRR7# \ dR#i;i)uKRead a small text file, or ``""`` — never raises, never reads huge files.rz utf-8-sigr )encodingerrors)rstatst_size_MAX_FACT_FILE_BYTES read_textro)rs&r# _read_smallr(sN||~~!4!47K!K~~{9~EE sA#AA AAcD]tRtRt$RtR]R&R]R&R]R&R]R&RtR #) ProjectFactsiuaStructured project facts — exposed so non-prompt consumers (desktop verify UI) don't re-detect.r manifestspackage_managersverify_commands context_filesrN)rrrrrr r!rr"r#r*r*skr"r*c V^8dQhRRRR/#)r&rrr(r*r)r)s"r#r*r*st r"c aaaa.pSR, R, P4'dVPR4SR, P4'd\P!\ SR, 4;'gR4P R4;'g/o\V3Rl\4R4oVPVV3Rl\44SR , P4'gR \ SR , 49dVPR 4\ SR , 4oVPV3Rl\44\\Uu.uF0q"\9gKSV, P4'gK.VNK2 up\\ P#V3Rl.\$O\O444\\ P#V44R\&\Uu.uF$pSV, P4'gK"VNK& upR7# \P \3d/oELi;iuupiuupi)z^Detect manifests, package manager(s), verify commands, context files (single source of truth).scriptsz run_tests.shzscripts/run_tests.sh package.jsonz{}c3j<"TF(wrSV, P4'gK$VxK* R#5ir-rr.lockpmrs& r#r1'detect_project_facts..s$RXT4$;:O:O:Qbb!3 3npmc3B<"TFqS9gK S RV 2xK R#5i)z run Nr)r.rjs_pmr1s& r#r1r8s$[SZ?+uTF+sz pytest.iniz [tool.pytestpyproject.tomlpytestMakefilec3<"TFZpS'gK \P!R\P!V4 R2S\P4'gKSRV 2xK\ R#5i)^z\s*:zmake N)researchescape MULTILINE)r.rmakefiles& r#r1r8sM#24   Qryy&7t")2244 ,- ~&&(( jjTN-B!C!K!KtLPPQZ[aa_aGRRTYZ [[[ |$$&&.KO_H_<`*` h4*,-H MM#2 .c.>2I1tVWxN`N`Nb11.cdmm, ???,   T]]6234I5IJ"0I.QTAX4F4F4Hqq.I  $$n5 G d Js<(H)H) H) I 1I I 7II)I  I c V^8dQhRRRR/#)r&rSrTr(z%tuple[Optional[Path], Optional[Path]]r)r)s"r#r*r*s88.83X8r"cZ\V4p\V4pY";'g \V43#)zR(git_root, workspace_root) for *cwd*; workspace root is git root else marker root.)r\rkr~)rSresolvedrs& r#_workspace_rootsr[s,C H"H 77h!7 77r"c V^8dQhRRRR/#)r&rSrTr(r<r)r)s"r#r*r*s  / ;S r"c \V4wrVfR#\V4pR\V4RVPRVPRVP RVP /#)uZStructured project facts for ``cwd`` (desktop verify UI) — ``None`` outside a workspace.Nrr+packageManagersverifyCommands contextFiles)r[rWrr+r,r-r.)rS_rfs& r#project_facts_forrcs[s#GA |T"AD Q[[1--!++  r"uRWorkspace (snapshot at session start — re-check with `git` before acting on it):c V^8dQhRRRR/#)r&rSrTr(rr)r)s"r#r*r*s66&:6c6r"c\V4wrVfR#\RV 2.pVEe^RIHpV!V4pVfRM \ RR\ V4RRR.\ VR 7p\V4wrxVPR R4p V R 8XdVPR 4MV 'd|VPR R4VPRR4rVPR4'd RVR, 2MRp V 'dW3R-8wd RV RV R2MRp VPRV V V 24\VRR4\VRR4rV'diV'da\V4P4\V4P48wd,V 'd V R 8wdRV 2MRpVPRV R24VP4UUu.uFwppV'gKV RV 2NK pppTPRV'dRPV4MR 24\VR R!R"4pV'd*VPR#.R$VP!44O4\#V4pVP$'djVP&'d R%R&PVP&4 R2MRpVPR'RPVP$R(,4 V 24VP('d.VPR)R*PVP(4 24VP*'d.VPR+RPVP*4 24R,PV4#uuppi).uWorkspace snapshot for the system prompt (empty outside a workspace): git state when in a repo, plus project facts — so marker-only (non-git) projects still get one.rz- Root: )noninteractive_repo_git_envrrstatusz --porcelain=2z--branch)renvheadz (detached)z- Branch: (detached HEAD)r0rupstreamu → z (ahead z , behind )z - Branch: z rev-parsez --git-dirz--git-common-dirz on branch z- Worktree: linked, isolatedz (git state shared with primary tree). Changes here do not affect the main working tree or other agents; commit and push your changes, and open a PR if appropriate. z - Status: z, cleanlogz-3z--pretty=%h %sz- Recent commits:c3,"TF pRV 2xK R#5i)z Nr)r.rVs& r#r1/build_coding_workspace_block..Fs0YEX4sEXsz (/z - Project: :NNz - Verify: z; z- Context files: r)rjrj)r[WORKSPACE_BLOCK_HEADERhermes_cli._subprocess_compatrfrrrrrGrrrrgr4rrMrrWr+r,r-r.)rSrrlinesrf status_envrgrrrirrrkabgit_dir common_dir on_branchlabelr/dirtyrecentrbmanagerss& r#rrs&c*NH | 4& E N06 !)/@ D#d)X KUagq0s&v.zz&"% <  LL4 5 "JJw4fjj36O6:@**Z:P:P&"4!56VXH9AuoYcFc8E7)F815ikB LL:dVH:bT: ; #4kBD{\nDo zd7m&;&;&=jAQAYAYA[&[049M+dV,SUI LL.yk:&& ' 17 DHE1!A3awD ze$))E"2!IJKdE4)9:  LL-Z0YVEVEVEX0YZ [T"A{{{;<;M;M;MR!3!345Q7SU {499Q[[_#=">xjIJ z$))A,=,=">!?@A (1??)C(DEF 99U Es 0 M M>racpclituidesktop)r=zsetup.pyz setup.cfgzrequirements.txtr2z tsconfig.jsonz deno.jsonz Cargo.tomlzgo.modzpom.xmlz build.gradlezbuild.gradle.ktsGemfilez composer.jsonzmix.exsz pubspec.yamlzCMakeLists.txtr? Dockerfile AGENTS.md CLAUDE.md .cursorrules)rrr> distvenvbuildtargetvendor __pycache__ node_modulesrb.next.venv.turbo))zuv.lockuv)z poetry.lockpoetry)z Pipfile.lockpipenv))zpnpm-lock.yamlpnpm)z bun.lockbbun)zbun.lockr)z yarn.lockyarn)zpackage-lock.jsonr:)testtestslint typecheckcheckrfmtr)i))gptcodexu- Edit format: author new files with `write_file`; for edits to existing code use `patch` with `mode='patch'` (V4A diff) — including single-file edits. It's the edit format you handle most reliably.))claudesonnetopushaikugeminigemmadeepseekqwenkimiglmgrokhermesllamamistraldevstralminimaxu- Edit format: author new files with `write_file`; for edits to existing code prefer `patch` in `mode='replace'` — match a unique snippet and swap it. Reach for `mode='patch'` (V4A) only when an edit genuinely spans several files at once.)apple communicationcookingcreativeemailfinancegaminggifshealthmediamusicz note-taking productivityshoppingz smart-homez social-mediatravelyuanbao)r strictlean)r trueyes1always)rfalsenorjneverr-)J__conditional_annotations__r __future__rrHloggingrZrBry dataclassesrpathlibrtypingrrrur getLoggerrrrr{rOrrrrrRrLrNrSr&rr r CODING_AGENT_GUIDANCErr_NON_CODING_SKILL_CATEGORIESrPrQrNrrrr9rHrQr\rkrqr~rrrrrrrrrrrrrrr(r*rWr[rcrtr)rs@r#rs #  ! ;   2 3 D <  "$*,139;ACIKPRWY`bgio !#').068>@EGOQUW\^eglnt  #%+-35>@DFKMRTZ\bdi !"Z  \!   A=(.d2V  mm/9 mm8$? mm8%@  $ 3 3 3!i0 >4IV^9E? !Y   4$ ; R $A@A@A@H!%CGlp2U4UUYUCU lDlVZl@Dl e$eTXe~Beh!%hCGhlphh26hY]hffcgfMQfS( $:8 n66r"